Sign In | Join Free | My flemtam.com
flemtam.com
Products
Search by Category
Home > Chemicals > Textile Chemicals >

Sermorelin Ghrp 6

sermorelin ghrp 6

All sermorelin ghrp 6 wholesalers & sermorelin ghrp 6 manufacturers come from members. We doesn't provide sermorelin ghrp 6 products or service, please contact them directly and verify their companies info carefully.

Total 8520 products from sermorelin ghrp 6 Manufactures & Suppliers
Quality Injectable hgh Growth Hormone Peptides steroids powder Sermorelin acetate cycle GHRH wholesale

Brand Name:SENDI

Model Number:YC001

Place of Origin:CHINA

Hello,This is Cherry from China.we offer Sermorelin 2mg/vial,CAS 86168-78-7 besides, we have offer GHRP peptide like GHRP-2;GHRP-6;ipamorelin;PEG-MGF;MGF if you are interested,plz ...

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier

Guangdong

Quality Sermorelin bodybuilding benefits Sermorelin Acetate ghrp-6 uses reviews buy online wholesale

Brand Name:steriodshow

Model Number:Sermorelin Acetate CAS 86168-78-7

Place of Origin:china manufactuer

Sermorelin Acetate Cas No.: 86168-78-7 Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Purity ...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Quality No Side Effect Sermorelin Peptides For Muscle Building 86168-78-7 wholesale

Brand Name:Yuancheng

Model Number:86168-78-7

Place of Origin:Wuhan,Hubei

98% Raw Sermorelin Human Growth Peptides Sermorelin White powder for Body - building Sermorelin - synthetic version of the peptide hormone GHRH Cas No.: 86168-78-7 Purity (HPLC): ...

Hubei Yuancheng Saichuang Technology Co., Ltd.
Verified Supplier

Hubei

Quality White Powder Sermorelin Acetate GRF 1-29 Peptide Hormones Bodybuilding wholesale

Brand Name:LSW

Model Number:CAS:86168-78-7

Place of Origin:China

Rleasing Hormone Polypeptide Lyophilized Powder Sermorelin 2mg with safe delivery and good quality Detail: Product Name: Sermorelin Synonyms: Sermorelin acetate, GRF 1-29 CAS: ...

Wuhan Lianshangwang Technology Co.,LTD
Verified Supplier

Hong Kong

Quality Sermorelin Anabolic Androgenic Steroids Peptide CAS 86168-78-7 Medicine Grade 99% wholesale

Brand Name:Nanjian

Model Number:Wuhan2017022

Place of Origin:China

Sermorelin Anabolic Androgenic Steroids Peptide CAS 86168-78-7 Purity 98% Sermorelin 2mg (GRF 1-29) Peptide Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly...

Tai'an Jia Ye Biological Technology Co.,Ltd
Verified Supplier

Quality CAS 86168-78-7 Growth Hormone Peptides Energy Increasing Sermorelin wholesale

Brand Name:Biopro

Model Number:GHP-42

Place of Origin:China

CAS 86168-78-7 Growth Hormone Peptides Energy Increasing Sermorelin 1. Quick Details: Product name: Sermorelin Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly...

Biopro Chemicals Co., Ltd.
Verified Supplier

Shanghai

Quality Peptides Ghrp -6 for Bodybuilder , GMP OEM performance pharma steroids 10mg / Vial wholesale

Brand Name:HZ

Model Number:87616-84-0

Place of Origin:China

Muscle Building Ghrp-6 for Bodybuilder with GMP (OEM) 10mg/Vial Basic Info CAS:87616-84-0 MF:C46H56N12O6 Other name:GHRP-6 Acetate; His(1)-lys(6)-ghrp; GH-Releasing peptide Purity:...

Wuhan Hezhong Biochemical Manufacturing Co., Ltd.
Verified Supplier

Hubei

Quality Diagnostic Agent Sermorelin 2mg Peptides Hormones CAS 86168-78-7 wholesale

Brand Name:Shuangbojie

Model Number:nutrition@chembj.com

Place of Origin:China

Polypeptide Hormone Sermorelin 2mg CAS 86168-78-7 for Diagnostic Agent Usage Product Name: Sermorelin Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR...

Zhuhaishi Shuangbojie Technology Co., Ltd
Verified Supplier

Guangdong

Quality Pharmaceutical Polypeptide Hormones Sermorelin 2mg Egrifta Pralmorelin GHRP-2 wholesale

Brand Name:HKSTEROIDS

Model Number:158861-67-7

Place of Origin:China

1. Quick Detail: Pralmorelin Unit Size :2 mg/vial Unit Quantity :1 Vial C6H9O-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hong Kong

Quality Raw Human Growth Peptides , Medical Ghrp 2 For Women 221231-10-3 wholesale

Brand Name:huao

Model Number:221231-10-3

Place of Origin:China

Human Growth Peptides 99 . 9 % GHRP-2 5mg/vial Muscle Gain and Anti Aging 1 . Quick Detail Product Name GHRP-2 (Pralmorelin) Apperance: White powder CAS NO.: 158861-67-7 Purity: 98...

Guangzhou Huao Chemical Co.,Ltd
Verified Supplier

Guangdong

Quality Human Growth Hormone Peptides Sermorelin Anti Aging / GRF 1-29  For Muscle Building CAS 86168-78-7 wholesale

Brand Name:SMQ

Model Number:growth hormone peptides

Place of Origin:china

2mg Growth Hormone Peptides Sermorelin / GRF 1-29 for Muscle Building CAS 86168-78-7 Quick detail Product Name Sermorelin Chemical Name Sermorelin Acetate,GRF 1-29, CAS Number ...

Shenzhen Simeiquan Biotechnology Co., Ltd.
Verified Supplier

Guangdong

Quality High Purity Human Growth Hormone Peptide Sermorelin For Short Stature Treatment wholesale

Brand Name:YIHAN

Model Number:Sermorelin

Place of Origin:China

High Purity Human Growth Hormone Peptide Sermorelin For Short Stature Treatment Detailed Product Description Product Name Sermorelin Apperance: White powder CAS NO.: 86168-78-7 ...

Yihan Industrial Co.,Ltd.
Verified Supplier

Hongkong

Quality Sermorelin 2mg/vial Growth Hormone Peptides Lyophilized Powder With Delivery Guarantee wholesale

Brand Name:Shuangbojie

Model Number:86168-78-7

Place of Origin:China

Sermorelin 2mg/vial Growth Hormone Peptides Lyophilized Powder With Delivery Guarantee 1) Sermorelin Details: Name: Sermorelin Synonyms: Sermorelin;Sermorelin acetate;Yadaiftnsyrkv...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Quality Human Growth Peptide White Powders Injection Sermorelin for Muscle Bodybuilding 86168-78-7 wholesale

Brand Name:NJBN

Model Number:86168-78-7

Place of Origin:MADE IN CHINA

Human Growth Peptide Injection Sermorelin for Muscle Bodybuilding 86168-78-7 Quick Details for Sermorelin Acetate Product name : Sermorelin Alias: GRF 1-29 NH2, Sermorelin Acetate ...

Nanjing Bangnuo Biotechnology Co., Ltd
Verified Supplier

Jiangsu

Quality Peptide Steroid hormones GHRP-2 5mg/vial 10mg/vial Purchase Peptides wholesale

Place of Origin:Wuhan, Hubei, China

Brand Name:YCGC

Peptide Steroid hormones GHRP-2 5mg/vial 10mg/vial Purchase Peptides Sequence: H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2 Molecular formula: C45H55N9O6 Molar Mass: 817.9 CAS number: ...

Wuhan Yuancheng Gongchuang Technology Co., Ltd.
Verified Supplier

Hubei

Quality Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical wholesale

Brand Name:Fulu

Model Number:86168-78-7

Place of Origin:China

Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical Quick detail Product Name Sermorelin Chemical Name Sermorelin Acetate, GRF 1-29, CAS Number 86168-78-7 ...

SuZhou FuLu Biotech Co.,Ltd
Verified Supplier

Jiangsu

Quality Polypeptide Sermorelin Human Growth Hormone For Weight Loss CAS 86168-78-7 wholesale

Brand Name:Sermorelin

Model Number:86168-78-7

Place of Origin:China

Polypeptide Sermorelin Human Growth Hormone For Weight Loss CAS 86168-78-7 Quick Detail: Product name: Sermorelin Synonyms: Sermorelin acetate hydrate, GRF 1-29 NH2 Sequence: H-Tyr...

Shenzhen RuiJin Pharmaceutical Co.,Ltd
Verified Supplier

Guangdong

Quality High Purity and 2016 Newly Produced Sermorelin Improving Sleep wholesale

Brand Name:HKYC

Model Number:86168-78-7

Place of Origin:China

High Purity and 2016 Newly Produced Sermorelin Improving Sleep Basic Info Port: China Production Capacity: 1000vial/Week Payment Terms:T/T, Western Union, Money Gram Model NO.: ...

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Quality Anti aging Sermorelin / Grf 1-29 human growth hormone supplements Bodybuilding CAS 86168-78-7 wholesale

Brand Name:YC

Model Number:86168-78-7

Place of Origin:China

2mg/ Vial Anti-aging Peptides Sermorelin / Grf 1-29 Bodybuilding Supplements CAS 86168-78-7 Gearprosteroids Product Name: Sermorelin Acetate, GRF 1-29 Gearprosteroids Alias: ...

Wuhan Yuancheng Technology Development Co., Ltd.
Verified Supplier

Hubei

Quality 158861-67-7 GHRP-2 Bodybuilding Growth Hormone Peptides KP 102 Pralmorelin wholesale

Brand Name:KANGDISEN

Model Number:5 mg/vial

Place of Origin:China

158861-67-7 GHRP-2 Bodybuilding Growth Hormone Peptides KP 102 Pralmorelin GHRP-2 GHRP-2 (also known as KP 102 or Pralmorelin) is a synthetic hexapeptide Growth Hormone Releasing ...

Hongkong Kangdisen Medical Co., Limited
Verified Supplier

Hong Kong

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request