Sign In | Join Free | My flemtam.com
flemtam.com
Products
Search by Category
Home > Chemicals > Textile Chemicals >

Sermorelin Ghrp 6

sermorelin ghrp 6

All sermorelin ghrp 6 wholesalers & sermorelin ghrp 6 manufacturers come from members. We doesn't provide sermorelin ghrp 6 products or service, please contact them directly and verify their companies info carefully.

Total 10460 products from sermorelin ghrp 6 Manufactures & Suppliers
Quality Injectable hgh Growth Hormone Peptides steroids powder Sermorelin acetate cycle GHRH wholesale

Brand Name:SENDI

Model Number:YC001

Place of Origin:CHINA

Hello,This is Cherry from China.we offer Sermorelin 2mg/vial,CAS 86168-78-7 besides, we have offer GHRP peptide like GHRP-2;GHRP-6;ipamorelin;PEG-MGF;MGF if you are interested,plz ...

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier

Guangdong

Quality Sermorelin bodybuilding benefits Sermorelin Acetate ghrp-6 uses reviews buy online wholesale

Brand Name:steriodshow

Model Number:Sermorelin Acetate CAS 86168-78-7

Place of Origin:china manufactuer

Sermorelin Acetate Cas No.: 86168-78-7 Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Purity ...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Quality 98% Raw Sermorelin Human Growth Peptides Sermorelin White powder for Body - building wholesale

Brand Name:Yuancheng

Model Number:86168-78-7

Place of Origin:Wuhan,Hubei

98% Raw Sermorelin Human Growth Peptides Sermorelin White powder for Body - building Sermorelin - synthetic version of the peptide hormone GHRH Cas No.: 86168-78-7 Purity (HPLC): ...

Hubei Yuancheng Saichuang Technology Co., Ltd.
Verified Supplier

Hubei

Quality White Powder Sermorelin Acetate GRF 1-29 Peptide Hormones Bodybuilding wholesale

Brand Name:LSW

Model Number:CAS:86168-78-7

Place of Origin:China

Rleasing Hormone Polypeptide Lyophilized Powder Sermorelin 2mg with safe delivery and good quality Detail: Product Name: Sermorelin Synonyms: Sermorelin acetate, GRF 1-29 CAS: ...

Wuhan Lianshangwang Technology Co.,LTD
Verified Supplier

Hong Kong

Quality Body Building Sermorelin Peptide Steroid Hormones White Powder 86168-78-7 wholesale

Brand Name:JNJG

Model Number:86168-78-7

Place of Origin:CHINA

White Powder Peptides 2mg/Vial Sermorelin Acetate For Bodybuilding 86168-78-7 Sermorelin Specification: Product Name Sermorelin Sermorelin CAS 86168-78-7 Sermorelin Alias ...

Jinan  Jiage  Biological Technology Co.,Ltd
Verified Supplier

Shandong

Quality 10mg/Vial Fat Loss Freeze Dried White Powder Peptide-6 Ghrp-6 87616-84-0 wholesale

Brand Name:Pharmagrade Steroids

Model Number:87616-84-0

Place of Origin:China

GHRP-6 release peptide-6 GHRP-6 10mg/vial*10vial/kit Description: CAS: 87616-84-0 Molecular Formula: C46H56N12O6 Molecular Weight: 873.01 Molecular weight: 873.01 Molar Mass: 873...

HUBEI PHARMAGRADE STEROIDS., LTD
Verified Supplier

Quality CAS158861-67-7  5mg / Vial Peptide Ghrp 6 , 99% Purity Research Chemicals Peptides wholesale

Brand Name:bodybiological

Model Number:158861-67-7

Place of Origin:Hubei, China

Research Chemical 99% Purity CAS158861-67-7 Peptides Ghrp 6 10mg/vial Basic Information for GHRP-6: Synonyms: GHRP-6 CAS NO.: 87616-84-0 Molecular Formula: C46H56N12O6 Molecular ...

Wuhan Body Biological Co.,Ltd
Verified Supplier

Hubei

Quality Diagnostic Agent Sermorelin 2mg Peptides Hormones CAS 86168-78-7 wholesale

Brand Name:Shuangbojie

Model Number:nutrition@chembj.com

Place of Origin:China

Polypeptide Hormone Sermorelin 2mg CAS 86168-78-7 for Diagnostic Agent Usage Product Name: Sermorelin Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR...

Zhuhaishi Shuangbojie Technology Co., Ltd
Verified Supplier

Guangdong

Quality CAS 86168-78-7 Human Growth Peptides Sermorelin Acetate 2mg Sermorelin Hormone wholesale

Brand Name:Guangzhou Huao

Model Number:86168-78-7

Place of Origin:Guangzhou China

Human Growth Peptides Sermorelin Acetate 2mg Sermorelin Hormone CAS 86168-78-7 Sermorelin Synonyms: GRF 1-29, Sermorelina, Sermoreline, Sermorelinum CAS NO.: 86168-78-7 Molecular ...

Guangzhou Huao Chemical Co.,Ltd
Verified Supplier

Guangdong

Quality Prohormones steroids Mix Ghrp-6(1mg) plus Ipamorelin (1mg) plus Cjc 1295(1mg) plus Mgf(500mcg) wholesale

Brand Name:YC Steroids

Place of Origin:China

Bodybuilding Peptides Mix Ghrp-6(1mg) plus Ipamorelin(1mg) plus Cjc 1295(1mg) plus Mgf(500mcg) Basic Information for GHRP-6 Synonyms: GHRP-6 CAS NO.: 87616-84-0 Molecular Formula: ...

Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
Verified Supplier

Hunan

Quality Pharmaceutical Growth Hormone Peptides GHRP-2 5MG Releasing Peptide For Muscle Gain and Anti Aging wholesale

Brand Name:BestSteroid

Model Number:158861-67-7

Place of Origin:Hubei,China

Growth Hormone Peptides GHRP-2 5MG Releasing Peptide For Muscle Gain and Anti Aging GHRP-2 Basic Info GHRP-2 (Pralmorelin) Alias: GHRP-2 Acetate CAS: 158861-67-7 M.F.: C42H50N8O5 M...

Hubei Yuancheng Saichuang Technology Co., Ltd.
Verified Supplier

Hubei

Quality Raw Steroid Powders 5mg Ghrp-2 Muscle Gain and Anti Aging Peptide Release Peptide-2 wholesale

Brand Name:HZ

Model Number:CAS:158861-67-7

Place of Origin:China

Muscle Gain and Anti Aging Peptide Hormones GHRP-2 Release Peptide-2 GHRP-2 GHRP-2 Releasing Peptide - 2 (GHRP2) Quick Detail: GHRP-2 release peptide-2 GHRP-2 Specification:10mg...

Wuhan Hezhong Biochemical Manufacturing Co., Ltd.
Verified Supplier

Hubei

Quality Research Chemical 99.9% Human Growth Peptide Powder 10mg/vial Ghrp-6 For Weight Loss wholesale

Brand Name:Muscle Man

Model Number:87616-84-0

Place of Origin:China, Hunan

Research Chemical 99.9% Human Growth Peptide Powder 10mg/vial Ghrp-6 For Weight Loss Quick detail: Ghrp-6 Product Name: GHRP-6 Ghrp-6 Chemical Name: Growth hormon releasing peptide...

Zhuzhou Interial Biotechnology Co., Ltd
Verified Supplier

Hunan

Quality Human Growth Hormone Peptides Sermorelin Anti Aging / GRF 1-29  For Muscle Building CAS 86168-78-7 wholesale

Brand Name:SMQ

Model Number:growth hormone peptides

Place of Origin:china

2mg Growth Hormone Peptides Sermorelin / GRF 1-29 for Muscle Building CAS 86168-78-7 Quick detail Product Name Sermorelin Chemical Name Sermorelin Acetate,GRF 1-29, CAS Number ...

Shenzhen Simeiquan Biotechnology Co., Ltd.
Verified Supplier

Guangdong

Quality High Purity Human Growth Hormone Peptide Sermorelin For Short Stature Treatment wholesale

Brand Name:YIHAN

Model Number:Sermorelin

Place of Origin:China

High Purity Human Growth Hormone Peptide Sermorelin For Short Stature Treatment Detailed Product Description Product Name Sermorelin Apperance: White powder CAS NO.: 86168-78-7 ...

Yihan Industrial Co.,Ltd.
Verified Supplier

Hongkong

Quality Sermorelin 2mg/vial Growth Hormone Peptides Lyophilized Powder With Delivery Guarantee wholesale

Brand Name:Shuangbojie

Model Number:86168-78-7

Place of Origin:China

Sermorelin 2mg/vial Growth Hormone Peptides Lyophilized Powder With Delivery Guarantee 1) Sermorelin Details: Name: Sermorelin Synonyms: Sermorelin;Sermorelin acetate;Yadaiftnsyrkv...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Quality Human Growth Peptide White Powders Injection Sermorelin for Muscle Bodybuilding 86168-78-7 wholesale

Brand Name:NJBN

Model Number:86168-78-7

Place of Origin:MADE IN CHINA

Human Growth Peptide Injection Sermorelin for Muscle Bodybuilding 86168-78-7 Quick Details for Sermorelin Acetate Product name : Sermorelin Alias: GRF 1-29 NH2, Sermorelin Acetate ...

Nanjing Bangnuo Biotechnology Co., Ltd
Verified Supplier

Jiangsu

Quality Peptide Steroid hormones GHRP-2 5mg/vial 10mg/vial Purchase Peptides wholesale

Place of Origin:Wuhan, Hubei, China

Brand Name:YCGC

Peptide Steroid hormones GHRP-2 5mg/vial 10mg/vial Purchase Peptides Sequence: H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2 Molecular formula: C45H55N9O6 Molar Mass: 817.9 CAS number: ...

Wuhan Yuancheng Gongchuang Technology Co., Ltd.
Verified Supplier

Hubei

Quality Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical wholesale

Brand Name:Fulu

Model Number:86168-78-7

Place of Origin:China

Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical Quick detail Product Name Sermorelin Chemical Name Sermorelin Acetate, GRF 1-29, CAS Number 86168-78-7 ...

SuZhou FuLu Biotech Co.,Ltd
Verified Supplier

Jiangsu

Quality Sermorelin CAS 86168-78-7 Muscle Building Steroids Growth Hormone Releasing Hormones wholesale

Brand Name:HKGC

Model Number:86168-78-7

Place of Origin:China

Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Molecular formula: C149H246N44O42S Molar Mass: ...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hong Kong

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request