Sign In | Join Free | My
Search by Category
Home > Chemicals > Inorganic Acid >

Cjc 1295 And Ghrp 6

cjc 1295 and ghrp 6

All cjc 1295 and ghrp 6 wholesalers & cjc 1295 and ghrp 6 manufacturers come from members. We doesn't provide cjc 1295 and ghrp 6 products or service, please contact them directly and verify their companies info carefully.

Total 14175 products from cjc 1295 and ghrp 6 Manufactures & Suppliers
Buy cheap  product

Brand Name:Pharm


Place of Origin:whatsapp: +86 138 7101 4054

...High Purity Peptide CJC-1295 Without Dac (2mg/Vial) CAS:863288-34-0 Muscle Building CJC-1295 DAC vs. CJC-1295 No DAC Details: CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are Releasing Hormones (GHRH). Their...

Verified Supplier


Buy cheap  product

Brand Name:YIHAN

Model Number:Cjc-1295

Place of Origin:China

... Peptide Cjc 1295 Without Dac 2 mg/Via CAS 863288-34-0 Detailed Product Description Product Name: Cjc-1295 Without Dac Appearance: Lyophilized powder CAS NO.: 307297-39-8 Purity: 99% Alias: Cjc-1295 Application: Peptide Drum Alias: CJC-1295 Acetate...

Yihan Industrial Co.,Ltd.
Verified Supplier


Buy cheap  product

Brand Name:Pharmlab

Model Number:863288-34-0

Place of Origin:China

...Human Growth Hormone Peptide CJC 1295 No DAC For Body Performance Enhancement 1.Quick detail Product name : CJC-1295 without dac Synonyms: CJC-1295 without DAC, CJC 1295 w/o DAC CAS NO.: 863288-34-0 Molecular Formula: C152H252N44O42 Molecular weight: 3367...

Pharmlab Co.,Ltd
Verified Supplier


Buy cheap  product

Brand Name:wumeitech

Model Number:863288-34-0

Place of Origin:China

...Peptide Hormones Bodybuilding CJC-1295 Without DAC / CJC-1295 CJC-1295 Details CJC-1295 CAS No. 863288-34-0 CJC-1295 Molecular Formula C152H252N44O42 CJC-1295 Molecular weight 3367.2 CJC-1295 Synonyms CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29, ...

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier


Buy cheap  product

Brand Name:Bodybiological

Model Number:CJC 1295 with Dac

Place of Origin:Hubei, China

...-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2 Item: CJC1295 With Dac Synonyms: Mod GRF 1-29, CJC-1295 no DAC,CJC-1295 with DAC, CJC 1295 with DAC CAS No.: 863288-34-0 Molecular Formula: C165H271N47O46

Wuhan Body Biological Co.,Ltd
Verified Supplier


Buy cheap  product

Brand Name:yuancheng

Model Number:863288-34-0

Place of Origin:China

...-Ser-Arg-Lys(Maleimidopropionyl)-NH2 CJC-1295 (DAC) contains 30 amino acids. The modified version of GRF 1-29 demonstrates a high affinity towards GHRH receptors. The molecular weight of CJC-1295 (DAC) is 3647.28...

Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
Verified Supplier


Buy cheap  product

Brand Name:Sendi

Model Number:Pharmaceutical Grade

Place of Origin:China

...White Powder Growth Hormone Peptides CJC-1295 Without DAC for Muscle Gaining 2mg/vial Quick detail Product Name CJC-1295 without DAC Chemical Name CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29,Mod GRF 1-29 CAS...

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier


Buy cheap  product

Brand Name:Nanjian

Place of Origin:China

...White Lyophilized Peptide Powder 2mg CJC 1295 Without DAC CAS 863288-34-0 Product Name CJC-1295 Synonym CJC-1295 Acetate; CJC1295(Without DAC) CAS NO 863288-34-0 Molecular Formula C165H271N47O46 Molecular weight 3649.30 ...

Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
Verified Supplier


Buy cheap  product

Brand Name:JNJG

Model Number:Cjc1295

Place of Origin:CHINA

...Lab Supply Peptides Cjc-1295 Without DAC 2mg/Vial Powder For Bodybuilding Cjc-1295 Specification: Product Name Cjc1295 Cjc1295 Alias CJC1295 Without DAC Cjc1295 CAS 863288-34-0 Cjc1295 Molecular ...

Jinan  Jiage  Biological Technology Co.,Ltd
Verified Supplier


Buy cheap  product

Brand Name:CJC-1295 Without DAC

Model Number:863288-34-0

Place of Origin:China

...High purity legal peptides Steroids CJC-1295 Without DAC​​​ 2mg / Vial , CAS 863288-34-0 Not only has Cjc1295 shown the ability to ...

JCJ Logis Co.,ltd
Verified Supplier


Buy cheap  product

Brand Name:steriodshow

Model Number:863288-34-0

Place of Origin:china manufactuer

...Polypeptide Hormones CJC-1295 with DAC Anti Aging Hormones Acetate Growth Hormone CJC-1295 1. Quick Detail: Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO. :863288-34-0 Synonyms :CJC1295/DAC, CJC-1295 with dac, CJC 1295 Molecular Formula...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier


Buy cheap  product

Brand Name:HKYC


Place of Origin:HUBEI,CHINA

...CJC1295 Human Growth Peptide Steroid Cjc-1295 No Dac for Muscle Enhance CJC 1295 No DAC Basic Info Name CJC 1295 Alias CJC-1295 No DAC, CJC-1295 without DAC,Mod GRF 1-29 CAS 863288-34-0 M. F C152H252N44O42 M. W 3367.2 Purity (HPLC...

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Buy cheap  product

Brand Name:HBU

Model Number:51753-57-2

Place of Origin:CHINA

...99% Purity Cjc-1295 with Dac for Fat Burning 2mg / Vial Cjc-1295 with Dac Cjc-1295 with Dac CAS:51753-57-2 Other Name:Grf 1-29 Purity (HPLC):98% MF: C165H271N47O46 MW: ...

HongKong Blue Universal Co., Limited.
Verified Supplier


Buy cheap  product

Brand Name:ChineseHormone

Model Number:863288-34-0

Place of Origin:China

...Quick detail: CAS No.:863288-34-0 Chemical Name: CJC-1295 without DAC Formula:C152H252N44O42 One Letter Sequence:Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2 Three Letter Sequence:H-Tyr-D-Ala-Asp-...

Verified Supplier

Hong Kong

Buy cheap  product

Brand Name:Shuangbojie

Model Number:863288-34-0

Place of Origin:China

...Injectable CJC 1295 Growth Hormone Peptide CJC 1295 Without DAC Weight Loss 1. CJC 1295 Information: Product name: CJC 1295 Appearance: White Lyophilized Powder Purity (HPLC): 99.19% Single Impurity(HPLC): 1.0% Amino Acid Composition: 10% ...

Zhuhaishi Shuangbojie Technology Co., Ltd
Verified Supplier


Buy cheap  product

Brand Name:Ycphar

Model Number:863288-34-0

Place of Origin:China

...CJC-1295 Mod GRF 1-29 Growth Hormone Peptides CJC-1295 DAC Fat Loss CJC-1295 no DAC Quick Detail of CJC 1295 Product name CJC-1295 without DAC Synonyms Mod GRF 1-29, CJC-1295 no DAC Sequence Tyr-D-Ala-Asp-Ala-Ile...

Wuhan Yuancheng Technology Development Co., Ltd.
Verified Supplier


Buy cheap  product


Model Number:863288-34-0

Place of Origin:China

...Muscle Building CJC-1295 Synthetic GHRH 2 mg/vial Peptides CJC-1295 DAC CAS 863288-34-0 Abstract CJC-1295 DAC has shown some amazing results as a hormone releasing hormone (GHRH) analog. Not only has CJC-1295 shown the ability...

Zhongshan Yuanyang Bio-pharmaceutical Technology Co.,Ltd
Verified Supplier


Buy cheap  product

Brand Name:HKYC

Model Number:863288-34-0

Place of Origin:China

...: Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO. :863288-34-0 Synonyms :CJC1295/DAC, CJC-1295 with dac, CJC 1295 Molecular Formula :C165H269N47O46 Molecular Weight :3647.19 Sequence :H-Tyr-D-Ala-Asp-Ala-Ile-Phe...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hong Kong

Buy cheap  product

Brand Name:Biofriend

Model Number:87616-84-0

Place of Origin:China

...Bodybuilding Peptides Mix Ghrp-6(1mg) plus Ipamorelin(1mg) plus Cjc 1295(1mg) plus Mgf(500mcg) Prohormones Steroids Basic Information for GHRP-6 Synonyms: GHRP-6 CAS NO: 87616-84-0 Molecular Formula: C46H56N12O6 Molecular weight: 873.01 Molar...

Wuhan Biofriend Technology Co.,Ltd
Verified Supplier


Buy cheap  product

Brand Name:HGH

Model Number:Human Growth Hormone

Place of Origin:China

...Protuct Name CJC 1295 Appearance white power Molecular Formula C152H252N44O42 Place of Origin China (Mainland) Function bodybuilding, anti-aging ...

Zhongweiye Biological Technology
Site Member


Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request